Antibodies

View as table Download

Rabbit Polyclonal ZBRK1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ZBRK1 antibody was raised against a 20 amino acid peptide near the carboxy terminus of the human ZBRK1.

ZNF350 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 175-204 amino acids from the Central region of human ZNF350

Rabbit Polyclonal Anti-ZNF350 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ZNF350 Antibody: synthetic peptide directed towards the N terminal of human ZNF350. Synthetic peptide located within the following region: AFENIVHCSKSQFLLGQNHDIFDLRGKSLKSNLTLVNQSKGYEIKNSVEF

Rabbit Polyclonal Anti-ZNF350 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF350 antibody: synthetic peptide directed towards the N terminal of human ZNF350. Synthetic peptide located within the following region: QFLLGQNHDIFDLRGKSLKSNLTLVNQSKGYEIKNSVEFTGNGDSFLHAN

ZNF350 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 233-532 of human ZNF350 (NP_067645.3).
Modifications Unmodified