Rabbit Polyclonal ZBRK1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ZBRK1 antibody was raised against a 20 amino acid peptide near the carboxy terminus of the human ZBRK1. |
Rabbit Polyclonal ZBRK1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ZBRK1 antibody was raised against a 20 amino acid peptide near the carboxy terminus of the human ZBRK1. |
ZNF350 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 175-204 amino acids from the Central region of human ZNF350 |
Rabbit Polyclonal Anti-ZNF350 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ZNF350 Antibody: synthetic peptide directed towards the N terminal of human ZNF350. Synthetic peptide located within the following region: AFENIVHCSKSQFLLGQNHDIFDLRGKSLKSNLTLVNQSKGYEIKNSVEF |
Rabbit Polyclonal Anti-ZNF350 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ZNF350 antibody: synthetic peptide directed towards the N terminal of human ZNF350. Synthetic peptide located within the following region: QFLLGQNHDIFDLRGKSLKSNLTLVNQSKGYEIKNSVEFTGNGDSFLHAN |
ZNF350 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 233-532 of human ZNF350 (NP_067645.3). |
Modifications | Unmodified |