Rabbit Polyclonal Anti-ZNF367 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF367 antibody: synthetic peptide directed towards the C terminal of human ZNF367. Synthetic peptide located within the following region: GCLSRFTHANRHCPKHPYARLKREEPTDTLSKHQAADNKAAAEWLARYWE |
Rabbit Polyclonal Anti-Zfp367 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Zfp367 antibody is: synthetic peptide directed towards the C-terminal region of Rat Zfp367. Synthetic peptide located within the following region: AAEWLAKYWEMREQRTPTLKGKLVQKADQEQQDPLEYLQSDEEDDEKSGA |
Rabbit Polyclonal Anti-ZNF367 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF367 antibody: synthetic peptide directed towards the middle region of human ZNF367. Synthetic peptide located within the following region: DTVRDLINEGEHSSSRIRCNICNRVFPREKSLQAHKRTHTGERPYLCDYP |
Germany
Japan
United Kingdom
China