Rabbit Polyclonal Anti-ZNF37A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF37A Antibody: synthetic peptide directed towards the middle region of human ZNF37A. Synthetic peptide located within the following region: KPYECYACGKAFLRKSDLIKHQRIHTGEKPYECNECGKSFSEKSTLTKHL |
Rabbit Polyclonal Anti-ZNF37A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF37A antibody: synthetic peptide directed towards the middle region of human ZNF37A. Synthetic peptide located within the following region: QQRTHTGEKPYECHECGKTFTQKSAHTRHQRTHTGGKPYECHECGKTFYK |
Rabbit Polyclonal Anti-ZNF37A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF37A antibody: synthetic peptide directed towards the middle region of human ZNF37A. Synthetic peptide located within the following region: ECGKSFSEKSTLTQHQRTHTGEKPYECHECGKTFSFKSVLTVHQKTHTGE |
Rabbit Polyclonal Anti-ZNF37A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF37A antibody: synthetic peptide directed towards the C terminal of human ZNF37A. Synthetic peptide located within the following region: LIKHQRIHTGEKPYECNECGKSFSEKSTLTKHLRTHTGEKPYECIQCGKF |
ZNF37A Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ZNF37A |
ZNF37A rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ZNF37A |
Germany
Japan
United Kingdom
China
