Antibodies

Jump to Filters
View as table Download
ZNF416 Rabbit Polyclonal Antibody
TA339500

USD 310.00

5 Days

Rabbit Polyclonal Anti-ZNF416 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF416 antibody: synthetic peptide directed towards the N terminal of human ZNF416. Synthetic peptide located within the following region: QVRTPEASPSTQKIQSCDMCVPFLTDILHLTDLPGQELYLTGACAVFHQD
ZNF416 Rabbit Polyclonal Antibody
TA383562

USD 220.00

3 Weeks

ZNF416 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 495-594 of human ZNF416 (NP_060349.1).
Modifications Unmodified