Antibodies

View as table Download

Rabbit polyclonal anti-ZNF420 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ZNF420.

Rabbit Polyclonal Anti-ZNF420 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF420 antibody: synthetic peptide directed towards the N terminal of human ZNF420. Synthetic peptide located within the following region: LENYSNLVSLDLPSRCASKDLSPEKNTYETELSQWEMSDRLENCDLEESN

Rabbit Polyclonal Anti-ZNF420 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ZNF420

ZNF420 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ZNF420