Rabbit Polyclonal Anti-ZNF471 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF471 antibody: synthetic peptide directed towards the N terminal of human ZNF471. Synthetic peptide located within the following region: MNVEVVKVMPQDLVTFKDVAIDFSQEEWQWMNPAQKRLYRSMMLENYQSL |
Rabbit Polyclonal Anti-ZNF471 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF471 antibody is: synthetic peptide directed towards the C-terminal region of Human ZNF471. Synthetic peptide located within the following region: KPYECNECGKAFSQTSNLTQHQRIHTGEKPYKCTECGKAFSDSSSCAQHQ |
Rabbit Polyclonal Anti-ZNF471 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF471 antibody: synthetic peptide directed towards the N terminal of human ZNF471. Synthetic peptide located within the following region: KEIITHKETITKETEFKYTKFGKCIHLENIEESIYNHTSDKKSFSKNSMV |
Anti-ZNF471 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 67-81 amino acids of human zinc finger protein 471 |
ZNF471 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ZNF471 |
ZNF471 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 80-210 of human ZNF471 (NP_065864.2). |
| Modifications | Unmodified |
ZNF471 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 80-210 of human ZNF471 (NP_065864.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
