Antibodies

Jump to Filters
View as table Download
ZNF512 Rabbit Polyclonal Antibody
TA329661

USD 375.00

5 Days

Rabbit Polyclonal anti-ZNF512 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF512 antibody: synthetic peptide directed towards the middle region of human ZNF512. Synthetic peptide located within the following region: QLRSLAGMKYHVMANHNSLPILKAGDEIDEPSERERLRTVLKRLGKLRCM
ZNF512 Rabbit Polyclonal Antibody
TA365405

USD 380.00

4 Weeks

ZNF512 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ZNF512
ZNF512 Rabbit Polyclonal Antibody
TA369721

USD 380.00

4 Weeks

ZNF512 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ZNF512