Rabbit Polyclonal Anti-ZNF559 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF559 antibody: synthetic peptide directed towards the N terminal of human ZNF559. Synthetic peptide located within the following region: LPSSSHLRECVRIYGGERPYTHKEYVETFSHSTALFVHMQTQDGEKFYEC |
Rabbit Polyclonal Anti-ZNF559 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF559 antibody is: synthetic peptide directed towards the N-terminal region of Human ZNF559. Synthetic peptide located within the following region: QCEKAFRKPSIFTLHKKTDIGEELPNCNQCETAFSQHLHLVCKKTSQNLH |
Germany
Japan
United Kingdom
China
