Rabbit Polyclonal Anti-ZNF575 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF575 antibody: synthetic peptide directed towards the N terminal of human ZNF575. Synthetic peptide located within the following region: MLERGAESAAGATDPSPTGKEPVTKEAPHQGPPQKPSQSAPGPTASAGSP |
Rabbit Polyclonal Anti-ZNF575 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF575 antibody: synthetic peptide directed towards the C terminal of human ZNF575. Synthetic peptide located within the following region: RLCHDPPTAPGSQATAWHRCSSCGQAFGQRRLLLLHQRSHHQVEHKGERD |
Rabbit polyclonal anti-ZNF575 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human ZNF575. |
Rabbit Polyclonal Anti-ZNF575 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF575 Antibody: synthetic peptide directed towards the middle region of human ZNF575. Synthetic peptide located within the following region: FSYPSKLATHRLAHGGARPHPCPDCPKAFSYPSKLAAHRLTHSGARPHPC |
ZNF575 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ZNF575 |
Germany
Japan
United Kingdom
China