Rabbit Polyclonal Anti-ZNF581 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF581 Antibody: synthetic peptide directed towards the N terminal of human ZNF581. Synthetic peptide located within the following region: SSSIGSPQASSPPRPNHYLLIDTQGVPYTVLVDEESQREPGASGAPGQKK |
Rabbit Polyclonal Anti-ZNF581 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF581 antibody: synthetic peptide directed towards the middle region of human ZNF581. Synthetic peptide located within the following region: QREPGASGAPGQKKCYSCPVCSRVFEYMSYLQRHSITHSEVKPFECDICG |
ZNF581 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ZNF581 |
ZNF581 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human ZNF581 (NP_057619.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
