Antibodies

Jump to Filters
View as table Download
ZNF586 Rabbit Polyclonal Antibody
TA343395

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZNF586 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ZNF586 antibody is: synthetic peptide directed towards the middle region of Human ZNF586. Synthetic peptide located within the following region: SSSLLQHQRVHTRERPYECSECGKSFSLRSNLIHHQRVHTGERHECGQCG
ZNF586 Rabbit Polyclonal Antibody
TA355484

USD 360.00

5 Days

ZNF586 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human ZNF586