Rabbit Polyclonal Anti-ZNF610 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF610 antibody: synthetic peptide directed towards the N terminal of human ZNF610. Synthetic peptide located within the following region: KIYRSNQVEKFTNHRSSVSPLQKISSSFTTHIFNKYRNDLIDFPLLPQEE |
Rabbit Polyclonal Anti-ZNF610 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF610 antibody: synthetic peptide directed towards the N terminal of human ZNF610. Synthetic peptide located within the following region: LSIISMLKQRREPLILQSQVKIVKNTDGRECVRSVNTGRSCVLGSNAENK |
Carrier-free (BSA/glycerol-free) ZNF610 mouse monoclonal antibody,clone OTI3H2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZNF610 mouse monoclonal antibody,clone OTI3H2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZNF610 mouse monoclonal antibody,clone OTI3H2, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ZNF610 mouse monoclonal antibody,clone OTI3H2, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ZNF610 mouse monoclonal antibody,clone OTI3H2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China