Germany
Japan
United Kingdom
China
ZNF620 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 72-102 amino acids from the N-terminal region of human ZNF620 |
Antibodies
View as table Download
Rabbit Polyclonal anti-ZNF620 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF620 antibody: synthetic peptide directed towards the middle region of human ZNF620. Synthetic peptide located within the following region: TVHQRMHTGEKPYECKECGKRLSSNTALTQHQRIHTGEKPFECKECGKAF |
Rabbit Polyclonal anti-ZNF620 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF620 antibody: synthetic peptide directed towards the C terminal of human ZNF620. Synthetic peptide located within the following region: SQSAILNQHRRIHTGAKPYECGQCGKSFSQKATLIKHQRVHTGERPYKCG |
Rabbit Polyclonal Anti-ZNF620 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF620 antibody: synthetic peptide directed towards the N terminal of human ZNF620. Synthetic peptide located within the following region: GLDPWEPMGREALRGICPGDEARTEKEGLTPKDHVSKETESFRLMVGGLP |
Rabbit Polyclonal Anti-ZNF620 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF620 antibody: synthetic peptide directed towards the N terminal of human ZNF620. Synthetic peptide located within the following region: KETESFRLMVGGLPGNVSQHLDFGSSLEQPQGHWIIKTKSKRRHFTDTSA |
ZNF620 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human ZNF620 (NP_001243096.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ZNF620