Antibodies

Jump to Filters
View as table Download
ZNF667 Rabbit Polyclonal Antibody
TA306797

USD 430.00

5 Days

Rabbit Polyclonal MIPU1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen MIPU1 antibody was raised against a 17 amino acid peptide near the amino terminus of human MIPU1.
ZNF667 (Center) Rabbit Polyclonal Antibody
AP54708PU-N

USD 450.00

2 Weeks

ZNF667 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 310-340 amino acids from the Central region of human ZNF667
ZNF667 Rabbit Polyclonal Antibody
TA339541

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZNF667 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF667 antibody: synthetic peptide directed towards the middle region of human ZNF667. Synthetic peptide located within the following region: RGFKKKSVFVVHKRIHAGEKIPENAKALSQSLQQRSHHLENPFKCRKCGK