Antibodies

Jump to Filters
View as table Download
ZNF705D Rabbit Polyclonal Antibody
TA339660

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZNF705D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF705D antibody: synthetic peptide directed towards the middle region of human LOC728957. Synthetic peptide located within the following region: LGQKCYECDKSGKAFSQSSGFRGNKIIHIGEKPHACLLCGKAFSLSSDLR
ZNF705D Mouse Monoclonal Antibody [Clone ID: OTI1G1]
CF810709

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ZNF705D mouse monoclonal antibody,clone OTI1G1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
ZNF705D Mouse Monoclonal Antibody [Clone ID: OTI1G1]
TA810709

USD 379.00

In Stock

ZNF705D mouse monoclonal antibody,clone OTI1G1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
ZNF705D Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G1]
TA810709AM

USD 420.00

4 Weeks

ZNF705D mouse monoclonal antibody,clone OTI1G1, Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin
ZNF705D Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G1]
TA810709BM

USD 420.00

4 Weeks

ZNF705D mouse monoclonal antibody,clone OTI1G1, HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP
ZNF705D Mouse Monoclonal Antibody [Clone ID: OTI1G1]
TA810709S

USD 159.00

2 Days

ZNF705D mouse monoclonal antibody,clone OTI1G1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated