Rabbit Polyclonal Anti-ZNF709 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF709 antibody: synthetic peptide directed towards the N terminal of human ZNF709. Synthetic peptide located within the following region: DVMQETFVNLASIGENWEEKNIEDHKNQGRKLRSHMVERLCERKEGSQFG |
Rabbit Polyclonal Anti-ZNF709 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF709 antibody: synthetic peptide directed towards the N terminal of human ZNF709. Synthetic peptide located within the following region: KLRSHMVERLCERKEGSQFGETISQTPNPKPNKKTFTRVKPYECSVCGKD |
Germany
Japan
United Kingdom
China