Rabbit Polyclonal Anti-ZNF746 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF746 antibody is: synthetic peptide directed towards the N-terminal region of Human ZNF746. Synthetic peptide located within the following region: PWTMAATIQAMERKIESQAARLLSLEGRTGMAEKKLADCEKTAVEFGNQL |
Rabbit Polyclonal Anti-ZNF746 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF746 antibody: synthetic peptide directed towards the middle region of human ZNF746. Synthetic peptide located within the following region: TGPEGLPYSSPDNGEAILDPSQAPRPFNEPCKYPGRTKGFGHKPGLKKHP |
Germany
Japan
United Kingdom
China
