Rabbit Polyclonal Anti-ZNF750 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF750 antibody is: synthetic peptide directed towards the N-terminal region of Human ZNF750. Synthetic peptide located within the following region: MSLLKERKPKKPHYIPRPPGKPFKYKCFQCPFTCNEKSHLFNHMKYGLCK |
Rabbit Polyclonal Anti-ZNF750 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZINC FINGER PROTEIN 750 Antibody: synthetic peptide directed towards the middle region of human ZINC FINGER PROTEIN 750. Synthetic peptide located within the following region: NRKHVEFESPIPEAKDSSKAGQRDTEGSKMSPRAGSAATGSPGRPSPTDF |
Germany
Japan
United Kingdom
China