Antibodies

Jump to Filters
View as table Download
ZNF780A (N-term) Rabbit Polyclonal Antibody
AP54717PU-N

USD 450.00

2 Weeks

ZNF780A (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 61-91 amino acids from the N-terminal region of human ZNF780A
ZNF780A Rabbit Polyclonal Antibody
TA342131

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZNF780A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF780A antibody: synthetic peptide directed towards the N terminal of human ZNF780A. Synthetic peptide located within the following region: TSRRYPDLELKYGPEKVSPENDTSEVNLPKQVIKQISTTLGIEAFYFRND
ZNF780A Rabbit Polyclonal Antibody
TA355545

USD 360.00

5 Days

ZNF780A Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated