Rabbit Polyclonal Anti-ZNF92 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF92 antibody: synthetic peptide directed towards the C terminal of human ZNF92. Synthetic peptide located within the following region: YKYEECDKAFNKFSTLITHQIIYTGEKPCKHECGRAFNKSSNYTKEKLQT |
Rabbit Polyclonal Anti-ZNF92 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF92 antibody: synthetic peptide directed towards the C terminal of human ZNF92. Synthetic peptide located within the following region: KPYKYEECDKAFNKFSTLITHQIIYTGEKPCKHECGRAFNKSSNYTKEKL |
ZNF92 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human ZNF92 |
Germany
Japan
United Kingdom
China