Rabbit Polyclonal Anti-ZNRF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNRF1 antibody: synthetic peptide directed towards the N terminal of human ZNRF1. Synthetic peptide located within the following region: MGGKQSTAARSRGPFPGVSTDDSAVPPPGGAPHFGHYRTGGGAMGLRSRS |
ZNRF1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 58-86 amino acids from the Central region of human ZNRF1 |
Anti-ZNRF1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 65-86 amino acids of human zinc and ring finger 1, E3 ubiquitin protein ligase |
ZNRF1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human ZNRF1 (NP_115644.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China