Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-ZP1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ZP1. |
Antibodies
View as table Download
Rabbit polyclonal Anti-ZP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZP1 antibody: synthetic peptide directed towards the middle region of human ZP1. Synthetic peptide located within the following region: TLEHWDVNKRDYIGTHLSQEQCQVASGHLPCIVRRTSKEACQQAGCCYDN |
Rabbit polyclonal Anti-ZP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZP1 antibody: synthetic peptide directed towards the middle region of human ZP1. Synthetic peptide located within the following region: PVGFEDSYGQEPTLGPTDSNGNSSLRPLLWAVLLLPAVALVLGFGVFVGL |
ZP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 340-610 of human ZP1 (NP_997224.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ZP1