Germany
Japan
United Kingdom
China
ZP4 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 452-482 amino acids from the C-terminal region of human ZP4 |
Antibodies
View as table Download
Rabbit polyclonal anti-ZP4 antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ZP4. |
Rabbit Polyclonal Anti-ZP4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZP4 antibody: synthetic peptide directed towards the N terminal of human ZP4. Synthetic peptide located within the following region: MWLLRCVLLCVSLSLAVSGQHKPEAPDYSSVLHCGPWSFQFAVNLNQEAT |
Active filters
Target Symbol
- ZP4