Antibodies

Jump to Filters
View as table Download
ZNF323 (ZSCAN31) Rabbit Polyclonal Antibody
TA341411

USD 310.00

5 Days

Rabbit Polyclonal Anti-ZNF323 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF323 antibody: synthetic peptide directed towards the middle region of human ZNF323. Synthetic peptide located within the following region: QEILKEMEHLGDSKLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHRC
ZNF323 (ZSCAN31) Rabbit Polyclonal Antibody
TA383628

USD 220.00

3 Weeks

ZSCAN31 Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 202-406 of human ZSCAN31 (NP_112161.3).
Modifications Unmodified