Antibodies

View as table Download

Rabbit polyclonal ZNF434 Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ZNF434 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 159-187 amino acids from the Central region of human ZNF434.

Rabbit Polyclonal Anti-ZNF434 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF434 antibody: synthetic peptide directed towards the N terminal of human ZNF434. Synthetic peptide located within the following region: GSDIEAGELNHQNGEPTEVEDGTVDGADRDEKDFRNPGQEVRKLDLPVLF