Rabbit polyclonal ZNF434 Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ZNF434 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 159-187 amino acids from the Central region of human ZNF434. |
Rabbit Polyclonal Anti-ZNF434 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF434 antibody: synthetic peptide directed towards the N terminal of human ZNF434. Synthetic peptide located within the following region: GSDIEAGELNHQNGEPTEVEDGTVDGADRDEKDFRNPGQEVRKLDLPVLF |
Germany
Japan
United Kingdom
China