Rabbit Polyclonal Anti-ZSCAN5A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZSCAN5A antibody is: synthetic peptide directed towards the C-terminal region of Human ZSCAN5A. Synthetic peptide located within the following region: KVFTYRGSLKEHQRIHSGEKPYKCSKCPRAFSRLKLLRRHQKTHPEATSQ |
Rabbit Polyclonal Anti-ZSCAN5A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZSCAN5A antibody is: synthetic peptide directed towards the middle region of human ZSCAN5A. Synthetic peptide located within the following region: GNRGDALNLSSPKRSKPDASSISQEEPQGEATPVGNRESPGQAGMNSIHS |
Rabbit Polyclonal Anti-ZSCAN5A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZSCAN5A antibody is: synthetic peptide directed towards the middle region of Human ZSCAN5A. Synthetic peptide located within the following region: QDSDIEMAEAPSSVRDDLKDVSSQRASSVNQMRPGEGQAHRELQILPRVP |
Rabbit Polyclonal Anti-ZSCAN5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZSCAN5 antibody: synthetic peptide directed towards the middle region of human ZSCAN5. Synthetic peptide located within the following region: KPDASSISQEEPQGEATPVGNRESPGQAGMNSIHSPGPASPVSHPDGQEA |
Germany
Japan
United Kingdom
China