Rabbit Polyclonal Anti-Zar1l Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Zar1l antibody is: synthetic peptide directed towards the C-terminal region of Mouse Zar1l. Synthetic peptide located within the following region: SQLLLPTWSRDREEQFPRLKELGEEYAHSPQDRKGKQFLELKYGYFHCKD |
Rabbit Polyclonal Anti-ZAR1L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZAR1L Antibody is: synthetic peptide directed towards the C-terminal region of Human ZAR1L. Synthetic peptide located within the following region: EPGQLEESGEKDAPCPQETKSKQVPGDAASEPLRRPNFQFLEPKYGYFHC |
Germany
Japan
United Kingdom
China