Antibodies

Jump to Filters
View as table Download
ZCCHC8 Rabbit Polyclonal Antibody
TA344986

USD 475.00

5 Days

Rabbit Polyclonal Anti-ZCCHC8 Antibody - C-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Zcchc8 antibody is: synthetic peptide directed towards the C-terminal region of Rat Zcchc8. Synthetic peptide located within the following region: FQPPLPPGTPPPLPQGTPPPLFTPPLPKGTPPLTPSDSPQPRPTASGVDE
ZCCHC8 Rabbit Polyclonal Antibody
TA383461

USD 220.00

3 Weeks

ZCCHC8 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human ZCCHC8 (NP_060082.2).
Modifications Unmodified