Antibodies

Jump to Filters
View as table Download
Secretory lectin ZG16 (ZG16) Rabbit Polyclonal Antibody
TA338822

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZG16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZG16 antibody: synthetic peptide directed towards the middle region of human ZG16. Synthetic peptide located within the following region: WSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFG
ZG16 Rabbit Polyclonal Antibody
TA366379

USD 380.00

4 Weeks

ZG16 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ZG16
ZG16 Rabbit Polyclonal Antibody
TA370727

USD 380.00

4 Weeks

ZG16 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ZG16