Antibodies

Jump to Filters
View as table Download
ZNHIT1 Rabbit Polyclonal Antibody
TA339701

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZNHIT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNHIT1 antibody: synthetic peptide directed towards the N terminal of human ZNHIT1. Synthetic peptide located within the following region: MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQ
ZNHIT1 Rabbit Polyclonal Antibody
TA365182

USD 380.00

4 Weeks

ZNHIT1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein
ZNHIT1 Rabbit Polyclonal Antibody
TA369499

USD 380.00

4 Weeks

ZNHIT1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein