Antibodies

Jump to Filters
View as table Download
ZXDC Rabbit Polyclonal Antibody
TA339665

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZXDC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZXDC antibody: synthetic peptide directed towards the middle region of human ZXDC. Synthetic peptide located within the following region: NLKAHMKGHEQESLFKCEVCAERFPTHAKLSSHQRSHFEPERPYKCDFPG
ZXDC Rabbit Polyclonal Antibody
TA360489

USD 360.00

5 Days

ZXDC Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZXDC