Rabbit Polyclonal Anti-C14orf105 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-C14orf105 antibody is: synthetic peptide directed towards the C-terminal region of Human C14orf105. Synthetic peptide located within the following region: WKIGKMETWLHEQEAQGQLLWDSSSSDSDEQGKDEKKPRALVRTRTERIP |
Rabbit Polyclonal Anti-C14orf105 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-C14orf105 antibody is: synthetic peptide directed towards the middle region of Human C14orf105. Synthetic peptide located within the following region: MIRKRQEAQMELKKSLHGEARINKQSPRDHKAKKTLQSTPRNDDHDLLTM |
Germany
Japan
United Kingdom
China