Antibody Sample

View as table Download

Rabbit polyclonal anti-ASF1B antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ASF1B.

Rabbit Polyclonal Anti-ASF1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASF1B antibody: synthetic peptide directed towards the middle region of human ASF1B. Synthetic peptide located within the following region: YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH

ASF1B Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 63-202 of human ASF1B (NP_060624.1).
Modifications Unmodified