Antibody Sample

Jump to Filters
View as table Download
MBD4 Rabbit Polyclonal Antibody
TA338199

USD 375.00

5 Days

Rabbit Polyclonal Anti-MBD4 Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MBD4 antibody: synthetic peptide directed towards the middle region of human MBD4. Synthetic peptide located within the following region: CSEQKTSGIINKFCSAKDSEHNEKYEDTFLESEEIGTKVEVVERKEHLHT