Antibody Sample

View as table Download

Goat Polyclonal Antibody against Vitamin D-binding protein / GC

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CDNLSTKNSKFED, from the internal region of the protein sequence according to NP_000574.2.

Rabbit Polyclonal Anti-GC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GC antibody: synthetic peptide directed towards the N terminal of human GC. Synthetic peptide located within the following region: KHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLV

Anti-GC Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 217-474 amino acids of human group-specific component (vitamin D binding protein)

GC Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 324-493 of human GC (NP_001191236.1).
Modifications Unmodified