Antibody Sample

cDNA Clones (7)
Proteins (4)
Antibodies (2)
Jump to Filters
View as table Download
ANXA2R Rabbit Polyclonal Antibody
TA334944

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-ANXA2R Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANXA2R antibody: synthetic peptide directed towards the N terminal of human ANXA2R. Synthetic peptide located within the following region: EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS
ANXA2R Rabbit Polyclonal Antibody
TA350997

USD 345.00

In Stock

Rabbit Polyclonal Anti-ANXA2R Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ANXA2R