Antibody Sample

View as table Download

HLA-A rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human HLA-A

Rabbit Polyclonal Anti-HLA-A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-A antibody is: synthetic peptide directed towards the N-terminal region of Human HLA-A. Synthetic peptide located within the following region: SDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQ

Carrier-free (BSA/glycerol-free) HLA mouse monoclonal antibody, clone OTI4D11

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HLA mouse monoclonal antibody, clone OTI2D11

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HLA mouse monoclonal antibody, clone OTI3H6

Applications WB
Reactivities Human
Conjugation Unconjugated

HLA-A Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human HLA-A

HLA-A Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide of Human HLA-A .
Modifications Unmodified

HLA A Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human HLA Class I. AA range:204-253

MHC Class I Rabbit polyclonal Antibody

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human MHC class I

MHC Class I Rabbit monoclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated