Antibody Sample

Jump to Filters
View as table Download
SHKBP1 Rabbit Polyclonal Antibody
TA309045

USD 415.00

5 Days

Rabbit polyclonal antibody to SHKBP1 (SH3KBP1 binding protein 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 162 and 477 of SHKBP1 (Uniprot ID#Q8TBC3)
SHKBP1 Rabbit Polyclonal Antibody
TA338729

USD 375.00

5 Days

Rabbit Polyclonal Anti-SHKBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SHKBP1 antibody is: synthetic peptide directed towards the N-terminal region of Human SHKBP1. Synthetic peptide located within the following region: TVFAPILNFLRTKELDPRGVHGSSLLHEAQFYGLTPLVRRLQLREELDRS