Antibody Sample

Jump to Filters
View as table Download
HLAA (HLA-A) Rabbit Polyclonal Antibody
TA343265

USD 375.00

5 Days

Rabbit Polyclonal Anti-HLA-A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-A antibody is: synthetic peptide directed towards the N-terminal region of Human HLA-A. Synthetic peptide located within the following region: SDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQ
HLAB (HLA-B) Mouse Monoclonal Antibody
TA354404

USD 345.00

5 Days

Mouse anti MHC I (HLA-A,B,C) Monoclonal Antibody

Reactivities Human
Conjugation Unconjugated
HLAA (HLA-A) Mouse Monoclonal Antibody [Clone ID: OTI4D11]
CF813375

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) HLA mouse monoclonal antibody, clone OTI4D11

Applications WB
Reactivities Human
Conjugation Unconjugated
HLAA (HLA-A) Mouse Monoclonal Antibody [Clone ID: OTI2D11]
CF813378

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) HLA mouse monoclonal antibody, clone OTI2D11

Applications WB
Reactivities Human
Conjugation Unconjugated
HLAA (HLA-A) Mouse Monoclonal Antibody [Clone ID: OTI3H6]
CF813379

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) HLA mouse monoclonal antibody, clone OTI3H6

Applications WB
Reactivities Human
Conjugation Unconjugated