Germany
Japan
United Kingdom
China
Fluorescent Protein Antibodies
View as table Download
Rabbit polyclonal IL3RA Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL3RA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 322-348 amino acids from the C-terminal region of human IL3RA. |
Rabbit Polyclonal Anti-IL3RA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL3RA antibody is: synthetic peptide directed towards the middle region of Human IL3RA. Synthetic peptide located within the following region: APADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQS |
IL5RA Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Antibody Hosts
- Rabbit
Pathways
- Jak-STAT signaling pathway