Fluorescent Protein Antibodies

Jump to Filters
View as table Download
TARP Rabbit Polyclonal Antibody
TA343054

USD 375.00

5 Days

Rabbit Polyclonal Anti-TARP Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-TARP antibody: synthetic peptide directed towards the N terminal of human TARP. Synthetic peptide located within the following region: YMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPK