Coronavirus Research Products

Jump to Filters
View as table Download
MASP2 Rabbit Polyclonal Antibody
TA346116

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-MASP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MASP2 antibody: synthetic peptide directed towards the N terminal of human MASP2. Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK
Angiotensin Converting Enzyme 2 (ACE2) Rabbit Polyclonal Antibody
AP05885PU-N

USD 425.00

5 Days

Angiotensin Converting Enzyme 2 (ACE2) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide corresponding to a sequence within the amino terminus of Human ACE2.