Research Areas

Jump to Filters
View as table Download
NFAT4 (NFATC3) Rabbit Polyclonal Antibody
TA330164

USD 375.00

5 Days

Rabbit Polyclonal Anti-NFATC3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NFATC3 antibody: synthetic peptide directed towards the N terminal of human NFATC3. Synthetic peptide located within the following region: AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSI
MEK2 (MAP2K2) Mouse Monoclonal Antibody [Clone ID: OTI8G6]
TA500471

USD 379.00

In Stock

Anti-MAP2K2 (MEK2 ) mouse monoclonal antibody, clone OTI8G6 (formerly 8G6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
FAK (PTK2) Mouse Monoclonal Antibody [Clone ID: OTI4A8]
TA506161

USD 379.00

In Stock

PTK2 (FAK) mouse monoclonal antibody, clone OTI4A8 (formerly 4A8)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated