Research Areas

Jump to Filters
View as table Download
MASP2 Rabbit Polyclonal Antibody
TA346116

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-MASP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MASP2 antibody: synthetic peptide directed towards the N terminal of human MASP2. Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK
CD46 Rabbit Polyclonal Antibody
TA324791

USD 450.00

5 Days

Rabbit polyclonal CD46 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CD46 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 317-343 amino acids from the C-terminal region of human CD46.