Research Areas

View as table Download

Rabbit Polyclonal Anti-FZD7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV

Goat Polyclonal Antibody against FZD7

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RFYHRLSHSSKGET, from the C Terminus of the protein sequence according to NP_003498.1.