Research Areas

Jump to Filters
View as table Download
LEF1 Rabbit Polyclonal Antibody
TA349379

USD 380.00

In Stock

Rabbit Polyclonal Anti-LEF1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human LEF1
TCF7L2 Rabbit Polyclonal Antibody
TA333645

USD 375.00

In Stock

Rabbit Polyclonal Anti-TCF7L2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the N terminal of human TCF7L2. Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN
B Raf (BRAF) Mouse Monoclonal Antibody [Clone ID: OTI5A9]
TA500431

USD 379.00

In Stock

BRAF mouse monoclonal antibody, clone OTI5A9 (formerly 5A9)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
MEK2 (MAP2K2) Mouse Monoclonal Antibody [Clone ID: OTI8G6]
TA500471

USD 379.00

In Stock

Anti-MAP2K2 (MEK2 ) mouse monoclonal antibody, clone OTI8G6 (formerly 8G6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
LEF1 Mouse Monoclonal Antibody [Clone ID: OTI10A7]
TA812988

USD 379.00

In Stock

LEF1 mouse monoclonal antibody,clone OTI10A7

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated