Research Areas

View as table Download

Rabbit Polyclonal Anti-LEF1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human LEF1

Rabbit Polyclonal Anti-TCF7L2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the N terminal of human TCF7L2. Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN

BRAF mouse monoclonal antibody, clone OTI5A9 (formerly 5A9)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Anti-MAP2K2 (MEK2 ) mouse monoclonal antibody, clone OTI8G6 (formerly 8G6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ARAF mouse monoclonal antibody, clone OTI2G9 (formerly 2G9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LEF1 mouse monoclonal antibody,clone OTI10A7

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated