Research Areas

View as table Download

Rabbit Polyclonal Anti-TCF21 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TCF21 Antibody: synthetic peptide directed towards the N terminal of human TCF21. Synthetic peptide located within the following region: SNCENGSPQKGRGGLGKRRKAPTKKSPLSGVSQEGKQVQRNAANARERAR

Rabbit polyclonal TCF21 Antibody (C-term)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TCF21 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 144-173 amino acids from the C-terminal region of human TCF21.

Rabbit Polyclonal Anti-TCF21 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TCF21 antibody: synthetic peptide directed towards the C terminal of human TCF21. Synthetic peptide located within the following region: RQILANDKYENGYIHPVNLTWPFMVAGKPESDLKEVVTASRLCGTTAS