Research Areas

View as table Download

Rabbit Polyclonal Anti-FRZB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FRZB antibody: synthetic peptide directed towards the N terminal of human FRZB. Synthetic peptide located within the following region: HSTQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPC

Rabbit Polyclonal Anti-FRZB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FRZB antibody: synthetic peptide directed towards the middle region of human FRZB. Synthetic peptide located within the following region: VVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERS