Research Areas

View as table Download

WNT7B (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 7B (WNT7B)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, WNT7B (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 7B (WNT7B), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, WNT7B (mGFP-tagged) - Human wingless-type MMTV integration site family, member 7B (WNT7B), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

WNT7B (GFP-tagged) - Human wingless-type MMTV integration site family, member 7B (WNT7B)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

WNT7B (untagged)-Human wingless-type MMTV integration site family, member 7B (WNT7B)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human wingless-type MMTV integration site family, member 7B (WNT7B), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human wingless-type MMTV integration site family, member 7B (WNT7B), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, WNT7B (mGFP-tagged) - Human wingless-type MMTV integration site family, member 7B (WNT7B), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Transient overexpression lysate of wingless-type MMTV integration site family, member 7B (WNT7B)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-WNT7B Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT7B antibody: synthetic peptide directed towards the middle region of human WNT7B. Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM

WNT7B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Lenti ORF clone of Human wingless-type MMTV integration site family, member 7B (WNT7B), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

USD 1,070.00

4 Weeks

Transient overexpression of WNT7B (NM_058238) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of WNT7B (NM_058238) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of WNT7B (NM_058238) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack