WNT7B (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 7B (WNT7B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
WNT7B (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 7B (WNT7B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, WNT7B (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 7B (WNT7B), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, WNT7B (mGFP-tagged) - Human wingless-type MMTV integration site family, member 7B (WNT7B), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
WNT7B (GFP-tagged) - Human wingless-type MMTV integration site family, member 7B (WNT7B)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
WNT7B (untagged)-Human wingless-type MMTV integration site family, member 7B (WNT7B)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 7B (WNT7B), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 7B (WNT7B), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, WNT7B (mGFP-tagged) - Human wingless-type MMTV integration site family, member 7B (WNT7B), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of wingless-type MMTV integration site family, member 7B (WNT7B)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-WNT7B Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT7B antibody: synthetic peptide directed towards the middle region of human WNT7B. Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM |
WNT7B HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 7B (WNT7B), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Transient overexpression of WNT7B (NM_058238) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of WNT7B (NM_058238) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of WNT7B (NM_058238) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack